| Site Title: |
Didn't we have some fun?
|
| Site Domain: |
rwywsitfpaisgaywlnwaiwawpwwgtmytwg.ytmnd.com |
| Created by: |
Aldrai
|
| Created on: |
2007-12-10 23:12:55 |
| Image Origin: |
Portal |
| Sound Origin: |
Portal |
| Preview: |
|
| Description: |
|
| Keywords: |
|
| Rating: |
|
| Total Votes: |
6 |
| Site Views |
| Views Today | Views Yesterday | Views Last Week | Views Last Month | Views All Time |
| 0 | 1 | 2 | 6 | 285 |
|
| Your rating: |
Log in to vote (no users have this site on their favorites list!) |
| |
Report this site |
| Site Sponsorship: |
Sponsor this site! (Click here for more info) |
| |
No donations for this site. |
| Add a comment: |
|