| Site Information | |||||||||||
| Site Title: | LEmOn ParTy | ||||||||||
| Site Domain: | evenkeithrichardshasadamndigitalwatch.ytmnd.com | ||||||||||
| Created by: | fyrestorm | ||||||||||
| Created on: | 2009-04-20 09:41:32 | ||||||||||
| Image Origin: | Bill G Unit 4 LyFe!1!Q!! | ||||||||||
| Sound Origin: | http://www.mikseri.net/artists/?id=19062 | ||||||||||
| Preview: |
|
||||||||||
| Description: | Microsoft Mary number one at bustin nut. | ||||||||||
| Keywords: | |||||||||||
| Site Stats: | |||||||||||
| Rating: |
|
||||||||||
| Total Votes: | 16 | ||||||||||
| Site Views |
|
||||||||||
| Your rating: | Log in to vote (one user has this site on their favorites list) | ||||||||||
| Report this site | |||||||||||
| Site Sponsorship: | Sponsor this site! (Click here for more info) | ||||||||||
| No donations for this site. | |||||||||||
| Add a comment: | |||||||||||
| Comments: |
| http://thisisavideo.ytmnd.com/ | ||||||
| fixed audio | ||||||
| Bill gate rappers. | ||||||
| dead users are supposed to stay dead. |
-1 | |||||
| I told you i aint doin anymore promos |
-1 | |||||
| I told you i aint doin anymore promos | ||||||
| You wanna get high? | ||||||
| |||||||
